PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_3665g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 405aa    MW: 45486 Da    PI: 6.6451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_3665g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++v+ +G g+W++++++ g+ R++k+c++rw +yl
     MA_3665g0010 14 KGLWSPEEDEKLMRYVTTHGHGRWSAVPKHAGLERCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding48.61.9e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++ E++l+ d+++ lG++ W+ Ia +++ gRt++++k++w++
     MA_3665g0010  67 RGTFSAHEEKLITDLHAALGNR-WSQIATHLP-GRTDNEIKNFWNS 110
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.453965IPR017930Myb domain
SuperFamilySSF466891.88E-2912108IPR009057Homeodomain-like
SMARTSM007175.3E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001671.06E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2465116IPR009057Homeodomain-like
SMARTSM007173.2E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129418.13666116IPR017930Myb domain
PfamPF002494.5E-1367110IPR001005SANT/Myb domain
CDDcd001671.43E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRHLCCHKQ KLRKGLWSPE EDEKLMRYVT THGHGRWSAV PKHAGLERCG KSCRLRWINY  60
LRPDLKRGTF SAHEEKLITD LHAALGNRWS QIATHLPGRT DNEIKNFWNS CIKKKLRQLG  120
IDPDTHKLIS EAVNASDEKL SFEAQQVSIL HKVEDSFIAP APVANMSSED KCIKPSAISN  180
NAFLQKEFLD PNFCAESSSE GSNTNKHPKF MLMNPASYCS NPVLWLFPGS TISEMHGSQE  240
TLIYPGNPRF KAAEVHSTSI TPDLKQNSSE YAYNTMSCSD YSQAVATNQP IDLSPGTCLS  300
SFLSERSAIQ EELSLHSDHI QYCDNGQFWD SQDREAGKNP CILTTSQLED KDLNSLEMET  360
ATAVKWSDLL QQPFDSTVKD KVNHASCPTI AWQLQESSGF HGSCY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-28121162105C-Myb DNA-Binding Domain
1mse_C4e-28121162105C-Myb DNA-Binding Domain
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1103010.0BT110301.1 Picea glauca clone GQ03219_I08 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840401.13e-76PREDICTED: transcription factor MYB86
TrEMBLA0A096ZX691e-81A0A096ZX69_PHAEQ; MYB transcription factor 9
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.34e-78myb domain protein 55